Search the Site:
FreedomYou News
  • ...April 11, 2013...
    Weight Loss Always Includes the Pain of Detox
    If there is a diet program that promises pain-fee weight loss, don’t believe them.
    
Share This Page:
Visit Us On Facebook

FreedomYou Products

International Best Selling Series 
Read Book Reviews

 

      • Shipping: 3-5 business days within North America. 
      • E-Books are an immediate  download. Learn More


You can also: Order by check or money order
IDnamedescriptiondescription_longoption1titleoptions1option2titleoptions2option3titleoptions3unitpriceinventoryimagelinkshippingweightcategoryidprioritylocaleidproductcodesiteidpurchlink1purchlink2unitprice2specialoffersavingsdownloadlinkshippingcanadashippingoverseasrecommendshortrecommendlongproductfileidreducedfromsupplieractivespecialofferssellboxlookinsidelinkdbspecialoffers
Steps To Freedom Program (4 books)
Print Book Price: $53.00
Digital E-Book Price: $30.98
  • By Ron Lagerquist
  • $14 savings!
  • Fasting To Freedom
  • North American Diet
  • Foundation To All Freedom
  • Whole Foods & Healing Recipes
There is far more to becoming free from an unhealthy lifestyle then just learning how to eat better. If only it were that simple. What diet programs do not talk about is how to become free from emotional dependence on food. The Steps To Freedom Program is designed, not only to provide the best nutritional education, but also to equip you for the challenging step by step spiritual journey toward lifelong freedom, leaving that old, addictive lifestyle far behind forever. Freedom never tasted so good!
Fasting To Freedom (Revised Edition)
Print Book Price: $17.00
Digital E-Book Price: $11.49
  • by Ron Lagerquist
  • everything you need to know to fast safely
  • detoxification, healing, colon cleansing
  • spiritual renewal, self-control, deepened contentment
  • refreshed relationship with God.
  • how to prepare and safely end a fast
  • overcome emotional battles familiar with fasting
  • delicious fresh juice recipes
  • many encouraging fasting testimonies
  • 266 pgs. soft cover
Whole Foods & Healing Recipes
Print Book Price: $18.00
Digital E-Book Price: $11.49
  • by Ron Lagerquist
  • Complete guide to natural, delicious recipes
  • learn how to pick ripe fruit
  • delicious butter replacers and healthy vegetable soups
  • discover natural sweeteners
  • omega 3 and 6 salad dressings
  • super tasty avocado dips
  • dozens of rare raw food recipes
  • herb and spice guide
  • how to furnish your new health conscious kitchen
  • 290 pgs. soft cover
North American Diet
Print Book Price: $15.00
Digital E-Book Price: $11.49
  • By Ron Lagerquist
  • What not to eat and why
  • what is making you sick
  • stop premature aging
  • toxic free diet
  • see food from a cellular level
  • the danger of hydrogenated oils and trans-fatty acids
  • shocking information on processed foods
  • 134 pgs. soft cover
Foundation To All Freedom
Print Book Price: $17.00
Digital E-Book Price: $11.49
  • by Ron Lagerquist
  • awaken from spiritual paralysis
  • gain control over your thinking
  • examining the media message
  • break old patterns, hopelessness and depression
  • re-establishing meaningful living
  • fulfill the heart-dream you were born with
  • learn the secret of developing spiritual self-discipline
  • 182 pgs. soft cover
The Know-It-All Health Nut
Digital E-Book Price: $11.49
  • by Ron Lagerquist
  • Permanent weight loss
  • Reverse aging. Seriously!
  • Choosing the best fats, carbs and protein foods
  • Strategic grocery shopping
  • What do my cells really need
  • How to make the hard changes
  • A fun and easy read
  • 229 pages
The Know-It-All Health Nut was written out of a mix of research and personal lessons learned while journeying from sickness to health. I believe it will be the most informative, honest and inspirational book you will ever read on how to make the hard choices so you can achieve a lifetime of vitality.
Samson Advanced Chrome Juicer
Price: $299.00
SPECIAL OFFER
FREE Steps To Freedom 4 E-Book Series with juicer purchase. A $30 Value! Immediate download.
  • Masticating, patented single rotating gear
  • 1.5 HP Squeezing Power
  • 1/3-HP, Single Phase Induction Motor
  • Motor Speed: 1750 RPM Auger Speed: 80 RPM
  • Dimensions 15" L x 12" W x 7" H
  • 15 Year Warranty
The Samson Advanced Chrome Juicer does so much more than produce the finest juice in the world. Baby food, frozen smoothies, nut butter, pasta, minced produce, wheat grass, and, with the added oil extractor attachment, it is able to harvest fresh oil from seeds like flax. Due to the slow 80-RPM masticating action of the GE-Ultem™ hard auger, this juicer reduces the amount of oxidation, resulting in a higher enzyme yield compared to centrifugal-type juicers. The auger uses a press-like action, squeezing more of the colors from the fibers of produce, and this is especially true when it comes to hard greens like kale or wheat grass. More color means increased antioxidants in your juice.
Samson Advanced White Juicer
Price: $259.00
SPECIAL OFFER
FREE Steps To Freedom 4 E-Book Series with juicer purchase. A $30 Value! Immediate download.
  • Masticating, patented single rotating gear
  • 1.5 HP Squeezing Power
  • 1/3-HP, Single Phase Induction Motor
  • Motor Speed: 1750 RPM Auger Speed: 80 RPM
  • Dimensions 15" L x 12" W x 7" H
  • 15 Year Warranty
The Samson Advanced White Juicer does so much more than produce the finest juice in the world. Baby food, frozen smoothies, nut butter, pasta, minced produce, wheat grass, and, with the added oil extractor attachment, it is able to harvest fresh oil from seeds like flax. Due to the slow 80-RPM masticating action of the GE-Ultem™ hard auger, this juicer reduces the amount of oxidation, resulting in a higher enzyme yield compared to centrifugal-type juicers. The auger uses a press-like action, squeezing more of the colors from the fibers of produce, and this is especially true when it comes to hard greens like kale or wheat grass. More color means increased antioxidants in your juice.
Omega Big Mouth Juicer
Price: $219.00
SPECIAL OFFER
FREE Steps To Freedom 4 E-Book Series with juicer purchase. A $30 Value! Immediate download.
  • Makes pulp-free juices
  • Easy to use, easy to clean
  • Large capacity bowl
  • Whisper-quiet ½-horsepower motor
  • One Speed -11000 RPMs
  • Dimensions: 12.5 x 8 x 15 inches
  • 10-year warranty
The Omega Big Mouth Juicer is all about speed of juicing, speed of cleaning, and ease of use. This is the best-quality, large-hopper juicer on the market within the $200 price range. Omega believes in its own product so much that they provide an unheard-of 10-year warranty!
CitriStar Citrus Juicer
Price: $44.99
  • An 85 Watt Motor
  • Auto Start/Stop: Easy one-touch operation
  • Stainless Steel Locking Spout
  • Universal Ream
  • Stainless Steel Screen
  • Cord Storage
  • Sloped Juice Collector
The Tribest CitriStar Citrus Juicer has proven itself to be one of the best juicers for citrus fruits in its price range. As soon as you unpack this juicer you will be impressed by its sturdy construction. The powerful 85 watt motor, self-cleaning ream, and sloped juice collector insures the very best juice yield without that annoying clogging problem. I personally love the locking spout, eliminating juice from dripping all over your counter. After juicing, simply snap the spout in place, and in a few minutes come back and collect the last remaining juice.

E-Book Return Policy: There are no refunds for E-Books. Electronic Files that are damaged or can not be opened for any reason will be replaced. For assistance contact info@freedomyou.com

There is no refund available for hard copy books. Any books damaged during shipping will be replaced.

Check out our Juicer Return Policy

Give Us Your Feedback!
Average
Rating
4.5
CLICK on the STARS below to give us your rating & comments:
Your Comments
Wow! Thank you and may God bless you for doing this research. It is good and important to know what one does and should expect during fasting, and to be encouraged to go further in the mist of the physical body reactions. Thank God that Jesus showed us that its possible, and centuries down the line show research shows that its possible. God bless you, and may Christ be centered in everything you do. God bless you.
Namby
What great informative information. I don't know how to stop eating meat. I have always needed meat to feel full or have any energy. Sugar is my other addition. Wow how I hated to hear the truth! I must be calcium deficient. I have all the symptoms and have had them for years. I thank God for you and your web site.
e williams
What a pleasure it is to have found your books! I am absolutely enjoying the connection you have placed on the masterpiece within each of us and the Spirit with which connects us to our Loving Creator. Thank you for this excellent writing!
Sue Ann
I have read the first two books and am about 1/3 done with the third. What wonderful information. And it’s written to where even I can understand it. I made fried chicken strips and fried French fries last night for dinner. I took a few bites and just could not go on. All I could do was think of what it was doing to me. This morning my husband and I both had our first glass of fresh apple juice. They both tasted so good and alive. Not only a sight for poor eyes, but also a feast for the senses! I just want to thank you all for these books.
Lynne
Your books have been a blessing and a curse for me as it has made me aware of everything I am doing to keep my body sick. Thank you, your work is a blessing.
Raychel
Dear Mr. Lagerquist, despite not being a religious person per se, I wanted to write and state that I enjoyed your books and appreciate the information you have published. These facts about food are worth their own apostolic movement in your books and I teach these things daily in my job as a registered nurse.
Martin RN
I just finished 3 day water fast. I just purchased your Whole Foods & Healing Recipes e-book. Great stuff! Thank you.
Rob
I had bought all your e-books. I'm now devouring those and they are really changing my perspectives about so many things. Thank you, Ron, for your passionate and inspired writing. I'm particularly enjoying "Foundation to All Freedom". I've been in bondage to compulsive overeating and a North American diet for many years. I did want to tell you a few benefits I've already been experiencing during my fast. My sinuses are starting to feel so clean and clear! I've lost about 5 lbs. so far, and I know more will melt off as I go. I'm starting to feel more energy too. I've never been so hopeful about regaining my health and wholeness. Thank you for being willing to be a servant for the Lord. Your website, as well as both your testimonies, has really encouraged me.
Andrea
I purchased all 4 of your books online and the Foundation to All Freedom has blessed my soul tremendously it is also a good witnessing tool.
Deneen
I decided to do some research and God led me to Freedomyou. It changed my life forever. I gave my book away and I tell everyone I can about this site. I know that God birthed and ordained your ministry and thank God for it. With much appreciation.
Patty
I have read your book “Fasting to Freedom”. I could not put it down. I devoured every word and began to feel like I had made some sort of contact with a person that I could relate to
Brent
1
Page size:
select
Page: of 1
Items 1 to 15 of 11
My Top Pick Juicers
    
Sponsored Links